Recombinant Human C-C motif chemokine 16 (CCL16)

Product Overview

• Article Name: Recombinant Human C-C motif chemokine 16 (CCL16)
• Biozol Catalog Number: BYT-ORB1096113
• Supplier Catalog Number: orb1096113
• Alternative Catalog Number: BYT-ORB1096113-20, BYT-ORB1096113-100, BYT-ORB1096113-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Chemokine CC-4 , HCC-4, Chemokine LEC, IL-10-inducible chemokine, LCC-1, Liver-expressed chemokineLymphocyte and monocyte chemoattractant , LMCMonotactin-1 , MTN-1NCC-4, Small-inducible cytokine A16

Product Description

Recombinant Human C-C motif chemokine 16(CCL16)

Product Properties

• Molecular Weight: 13.8 kDa
• UniProt: O15467
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration