Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB)

Catalog Number: BYT-ORB1096114
Article Name: Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB)
Biozol Catalog Number: BYT-ORB1096114
Supplier Catalog Number: orb1096114
Alternative Catalog Number: BYT-ORB1096114-20, BYT-ORB1096114-100, BYT-ORB1096114-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Arg-gingipain Gingipain 2 RGP-2
Recombinant Porphyromonas gingivalis Gingipain R2(rgpB)
Molecular Weight: 57.1 kDa
UniProt: P95493
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLYNVP
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration