Recombinant Mouse High affinity cGMP-specific 3,5-cyclic phosphodiesterase 9A (Pde9a)

Product Overview

• Article Name: Recombinant Mouse High affinity cGMP-specific 3,5-cyclic phosphodiesterase 9A (Pde9a)
• Biozol Catalog Number: BYT-ORB1096118
• Supplier Catalog Number: orb1096118
• Alternative Catalog Number: BYT-ORB1096118-20, BYT-ORB1096118-100, BYT-ORB1096118-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

Recombinant Mouse High affinity cGMP-specific 3,5-cyclic phosphodiesterase 9A(Pde9a)

Product Properties

• Molecular Weight: 65.7 kDa
• UniProt: O70628
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MGAGSSSYRPKAIYLDIDGRIQKVVFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAVKQVSEREELIQGVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARNSRTNCPCKYSFLDNKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYRNNPFHNFR

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration