Recombinant Human Tryptase beta-2 (TPSB2)

Catalog Number: BYT-ORB1096123
Article Name: Recombinant Human Tryptase beta-2 (TPSB2)
Biozol Catalog Number: BYT-ORB1096123
Supplier Catalog Number: orb1096123
Alternative Catalog Number: BYT-ORB1096123-20, BYT-ORB1096123-100, BYT-ORB1096123-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Tryptase II
Recombinant Human Tryptase beta-2(TPSB2)
Molecular Weight: 34.9 kDa
UniProt: P20231
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration