Recombinant Human G-protein coupled receptor 35 (GPR35)

Product Overview

• Article Name: Recombinant Human G-protein coupled receptor 35 (GPR35)
• Biozol Catalog Number: BYT-ORB1096127
• Supplier Catalog Number: orb1096127
• Alternative Catalog Number: BYT-ORB1096127-20, BYT-ORB1096127-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Kynurenic acid receptor, KYNA receptor

Product Description

Recombinant Human G-protein coupled receptor 35(GPR35)

Product Properties

• Molecular Weight: 36.9 kDa
• UniProt: Q9HC97
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETI

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration