Recombinant Human herpesvirus 2 Envelope glycoprotein E (gE)

Product Overview

• Article Name: Recombinant Human herpesvirus 2 Envelope glycoprotein E (gE)
• Biozol Catalog Number: BYT-ORB1096128
• Supplier Catalog Number: orb1096128
• Alternative Catalog Number: BYT-ORB1096128-20, BYT-ORB1096128-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: gE, gE-2

Product Description

Recombinant Human herpesvirus 2 Envelope glycoprotein E(gE)

Product Properties

• Molecular Weight: 60.1 kDa
• UniProt: P89475
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AAPRTSWKRVTSGEDVVLLPAPAERTRAHKLLWAAEPLDACGPLRPSWVALWPPRRVLETVVDAACMRAPEPLAIAYSPPFPAGDEGLYSELAWRDRVAVVNESLVIYGALETDSGLYTLSVVGLSDEARQVASVVLVVEPAPVPTPTPDDYDEEDDAGVTNARRSAFPPQPPPRRPPVAPPTHPRVIPEVSHVRGVTVHMETLEAILFAPGETFGTNVSIHAIAHDDGPYAMDVVWMRFDVPSSCADMRIYEA

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration