Recombinant Bovine Leukocyte antigen CD37 (CD37)

Catalog Number: BYT-ORB1096129
Article Name: Recombinant Bovine Leukocyte antigen CD37 (CD37)
Biozol Catalog Number: BYT-ORB1096129
Supplier Catalog Number: orb1096129
Alternative Catalog Number: BYT-ORB1096129-20, BYT-ORB1096129-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CD37
Recombinant Bovine Leukocyte antigen CD37(CD37)
Molecular Weight: 37.8 kDa
UniProt: Q2KHY8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bos taurus (Bovine)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSAHDGCLSLVKYLLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLSFMPLQIWSKVLAVSGILTMGLALLGCVGALKEFRCLLGLYFGTLLLLFATQITLGILISTQRVQLKKKVKDVVQKTIQNYRTHPEETAAEESWDYVQFQLRCCGWESPQDWFHIPSMRRNESEGDRVPCSCYNSSATNDSTIFDKISPQFSRLGSLAQPRHNVEVCSVPANSYIYQQGCERNLSNWLTNNLISIVGICLGVGLL
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration