Recombinant Human C-C chemokine receptor type 8 (CCR8), partial

Product Overview

• Article Name: Recombinant Human C-C chemokine receptor type 8 (CCR8), partial
• Biozol Catalog Number: BYT-ORB1096132
• Supplier Catalog Number: orb1096132
• Alternative Catalog Number: BYT-ORB1096132-20, BYT-ORB1096132-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: CC chemokine receptor CHEMR1, CMKBRL2Chemokine receptor-like 1, CKR-L1, GPR-CY6, GPRCY6, TER1, CDw198

Product Description

Recombinant Human C-C chemokine receptor type 8(CCR8),partial

Product Properties

• Molecular Weight: 9.4 kDa
• UniProt: P51685
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration