Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial

Catalog Number: BYT-ORB1096133
Article Name: Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial
Biozol Catalog Number: BYT-ORB1096133
Supplier Catalog Number: orb1096133
Alternative Catalog Number: BYT-ORB1096133-20, BYT-ORB1096133-100, BYT-ORB1096133-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: OX40 ligand, OX40L, CD252
Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4(TNFSF4),partial
Molecular Weight: 44.9 kDa
UniProt: O02765
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Oryctolagus cuniculus (Rabbit)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration