Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT)

Catalog Number: BYT-ORB1096137
Article Name: Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT)
Biozol Catalog Number: BYT-ORB1096137
Supplier Catalog Number: orb1096137
Alternative Catalog Number: BYT-ORB1096137-20, BYT-ORB1096137-100, BYT-ORB1096137-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Glutaminyl cyclase , QC , sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase , EC
Recombinant Human Glutaminyl-peptide cyclotransferase(QPCT)
Molecular Weight: 41.5 kDa
UniProt: Q16769
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELG
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration