Recombinant Bovine coronavirus Nucleoprotein (N)

Catalog Number: BYT-ORB1096644
Article Name: Recombinant Bovine coronavirus Nucleoprotein (N)
Biozol Catalog Number: BYT-ORB1096644
Supplier Catalog Number: orb1096644
Alternative Catalog Number: BYT-ORB1096644-20, BYT-ORB1096644-100, BYT-ORB1096644-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Nucleocapsid protein, NC, Protein N
Recombinant Bovine coronavirus Nucleoprotein(N)
Molecular Weight: 50.3 kDa
UniProt: P59712
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bovine coronavirus (strain Quebec) (BCoV) (BCV)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQV
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration