Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial

Product Overview

• Article Name: Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial
• Biozol Catalog Number: BYT-ORB1096647
• Supplier Catalog Number: orb1096647
• Alternative Catalog Number: BYT-ORB1096647-20, BYT-ORB1096647-100, BYT-ORB1096647-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: S glycoproteinUniRule annotation, E2, Peplomer protein

Product Description

Recombinant Human coronavirus HKU1 Spike glycoprotein(S),partial

Product Properties

• Molecular Weight: 35.7 kDa
• UniProt: Q14EB0
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Human coronavirus HKU1 (isolate N2) (HCoV-HKU1)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: TVKPVATVYRRIPNLPDCDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSSCQLYYSLPLVNVTINNFNPSSWNRRYGFGSFNVSSYDVVYSDHCFSVNSDFCPCADPSVVNSCVKSKPLSAICPAGTKYRHCDLDTTLYVNNWCRCSCLPDPISTYSPNTCPQKKVVVGIGEHCPGLGINEEKCGTQLNHS

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration