Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)

Catalog Number: BYT-ORB1096650
Article Name: Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)
Biozol Catalog Number: BYT-ORB1096650
Supplier Catalog Number: orb1096650
Alternative Catalog Number: BYT-ORB1096650-20, BYT-ORB1096650-100, BYT-ORB1096650-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein
Recombinant Human coronavirus HKU1 Non-structural protein 4(4)
Molecular Weight: 13.4 kDa
UniProt: Q5MQC9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Human coronavirus HKU1 (isolate N1) (HCoV-HKU1)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDVWRPSYTHSLVIREFGVTNLEDLCLKYNYCQPIVGYCIVPLNVWCRKFGKFASHFTLRSHDISHSNNFGVVTSFTTYGNTVSEAVSRLVESASEFIVWRAEALNKYG
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration