Recombinant Bovine coronavirus Spike glycoprotein (S), partial

Catalog Number: BYT-ORB1096651
Article Name: Recombinant Bovine coronavirus Spike glycoprotein (S), partial
Biozol Catalog Number: BYT-ORB1096651
Supplier Catalog Number: orb1096651
Alternative Catalog Number: BYT-ORB1096651-20, BYT-ORB1096651-100, BYT-ORB1096651-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: E2, Peplomer protein
Recombinant Bovine coronavirus Spike glycoprotein(S),partial
Molecular Weight: 24.6 kDa
UniProt: P25194
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bovine coronavirus (strain vaccine) (BCoV) (BCV)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration