Recombinant Severe acute respiratory syndrome coronavirus 3C-like proteinase, partial

Product Overview

• Article Name: Recombinant Severe acute respiratory syndrome coronavirus 3C-like proteinase, partial
• Biozol Catalog Number: BYT-ORB1096654
• Supplier Catalog Number: orb1096654
• Alternative Catalog Number: BYT-ORB1096654-20, BYT-ORB1096654-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Growth factor-like peptide, Leader protein, Non-structural protein 10, Non-structural protein 2, Non-structural protein 3, Non-structural protein 4, Non-structural protein 6, Non-structural protein 7, Non-structural protein 8, Non-structural protein 9, P

Product Description

Recombinant Severe acute respiratory syndrome coronavirus 3C-like proteinase,partial

Product Properties

• Molecular Weight: 35.8 kDa
• UniProt: C8YZ74
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Severe acute respiratory syndrome coronavirus (SARS-CoV)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYM

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration