Recombinant Bovine coronavirus Non-structural protein 2a (2a)

Catalog Number: BYT-ORB1096658
Article Name: Recombinant Bovine coronavirus Non-structural protein 2a (2a)
Biozol Catalog Number: BYT-ORB1096658
Supplier Catalog Number: orb1096658
Alternative Catalog Number: BYT-ORB1096658-20, BYT-ORB1096658-100, BYT-ORB1096658-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ns2a, 32 kDa accessory protein, 32 kDa non-structural protein, ns2
Recombinant Bovine coronavirus Non-structural protein 2a(2a)
Molecular Weight: 34.4 kDa
UniProt: Q8V438
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAVAYADKPNHFINFPLTQFQGFVLNYKGLQFQLLDEGVDCKIQTAPHISLAMLDIQPEDYRSVDVAIQEVIDDMHWGEGFQIKFENPHILGRCIVLDVKGVEELHDDLVNYIRDKGCVDDQSRKWIGHCTIAQLTDAALSIKGNVDFINSMQFNYKITINPSSPARLEIVKLGAEKKDGFYETIASHWMGIRFEYNPPTDKLAMIMGYCCLEVVRKELEEGDLPENDDDAWFKLSYHYENNSWFFRHVYRKSS
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration