Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)

Product Overview

• Article Name: Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)
• Biozol Catalog Number: BYT-ORB1096672
• Supplier Catalog Number: orb1096672
• Alternative Catalog Number: BYT-ORB1096672-20, BYT-ORB1096672-100, BYT-ORB1096672-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein

Product Description

Recombinant Human coronavirus HKU1 Non-structural protein 4(4)

Product Properties

• Molecular Weight: 14 kDa
• UniProt: Q5MQC9
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Human coronavirus HKU1 (isolate N1) (HCoV-HKU1)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MDVWRPSYTHSLVIREFGVTNLEDLCLKYNYCQPIVGYCIVPLNVWCRKFGKFASHFTLRSHDISHSNNFGVVTSFTTYGNTVSEAVSRLVESASEFIVWRAEALNKYG

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration