If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source:
Bovine coronavirus (strain Quebec) (BCoV) (BCV)
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Sequence:
MPMATTIDGTDYTNIMPSTVSTRVYLGCSIGIDTSTTGFTCFSWY
Application Notes:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration
* VAT and and shipping costs not included. Errors and price changes excepted
