Recombinant Human coronavirus HKU1 Nucleoprotein (N)

Catalog Number: BYT-ORB1096679
Article Name: Recombinant Human coronavirus HKU1 Nucleoprotein (N)
Biozol Catalog Number: BYT-ORB1096679
Supplier Catalog Number: orb1096679
Alternative Catalog Number: BYT-ORB1096679-20, BYT-ORB1096679-100, BYT-ORB1096679-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Nucleocapsid protein, NC, Protein N
Recombinant Human coronavirus HKU1 Nucleoprotein(N)
Molecular Weight: 50.1 kDa
UniProt: Q0ZME3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSYTPGHHAGSRSSSGNRSGILKKTSWVDQSERSHQTYNRGRKPQPKFTVSTQPQGNPIPHYSWFSGITQFQKGRDFKFPDGQGVPIAYGIPPSEAKGYWYKHNRRSFKTADGQQKQLLPRWYFYYLGTGPYASSSYGDAHEGIFWVASHQADTSIPSDVSARDPTIQEAIPTRFSPGTILPQGYYVEGSGRSASNSRPGSRSQSRGPNNRSLSRSNSNFRHSDSIVKPDMADEIASLVLAKLGKDSKPQQVTK
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration