Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein (E & M), partial

Product Overview

• Article Name: Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein (E & M), partial
• Biozol Catalog Number: BYT-ORB1096682
• Supplier Catalog Number: orb1096682
• Alternative Catalog Number: BYT-ORB1096682-20, BYT-ORB1096682-100, BYT-ORB1096682-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: /

Product Description

Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein(E & M),partial

Product Properties

• Molecular Weight: 17.6 kDa
• UniProt: P0DTC5
• Buffer: Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Severe acute respiratory syndrome coronavirus 2
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration