Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial

Catalog Number: BYT-ORB1096685
Article Name: Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial
Biozol Catalog Number: BYT-ORB1096685
Supplier Catalog Number: orb1096685
Alternative Catalog Number: BYT-ORB1096685-20, BYT-ORB1096685-100, BYT-ORB1096685-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (S glycoprotein)(E2)(Peplomer protein)
Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein(S),partial
Molecular Weight: 27.2 kDa
UniProt: P59594
Buffer: Lyophilized from a 0.2 µm sterile fiiltered 20mM Tris-HCl,400mM NaCl,6% Trehalose,pH 7.0
Source: Severe acute respiratory syndrome coronavirus (SARS-CoV)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration