Recombinant Human Novel Coronavirus Spike glycoprotein(S)(K417N,E484K,N501Y),partial

Catalog Number: BYT-ORB1096686
Article Name: Recombinant Human Novel Coronavirus Spike glycoprotein(S)(K417N,E484K,N501Y),partial
Biozol Catalog Number: BYT-ORB1096686
Supplier Catalog Number: orb1096686
Alternative Catalog Number: BYT-ORB1096686-20, BYT-ORB1096686-100, BYT-ORB1096686-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (S glycoprotein)(Peplomer protein)(Spike protein S1)(Spike protein S2)
Recombinant Human Novel Coronavirus Spike glycoprotein(S)(K417N,E484K,N501Y),partial
Molecular Weight: 27.9 kDa
UniProt: P0DTC2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration