Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K),partial

Catalog Number: BYT-ORB1096688
Article Name: Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K),partial
Biozol Catalog Number: BYT-ORB1096688
Supplier Catalog Number: orb1096688
Alternative Catalog Number: BYT-ORB1096688-20, BYT-ORB1096688-100, BYT-ORB1096688-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: E2 Peplomer protein
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K),partial
Molecular Weight: 27.9 kDa
UniProt: P0DTC2
Buffer: Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration