Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial

Catalog Number: BYT-ORB1096689
Article Name: Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial
Biozol Catalog Number: BYT-ORB1096689
Supplier Catalog Number: orb1096689
Alternative Catalog Number: BYT-ORB1096689-20, BYT-ORB1096689-100, BYT-ORB1096689-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: E2 Peplomer protein
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial
Molecular Weight: 54.4 kDa
UniProt: P0DTC2
Buffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Source: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration