Recombinant Human Novel Coronavirus Spike glycoprotein(S)(N501Y,P681H),partial

Product Overview

• Article Name: Recombinant Human Novel Coronavirus Spike glycoprotein(S)(N501Y,P681H),partial
• Biozol Catalog Number: BYT-ORB1096693
• Supplier Catalog Number: orb1096693
• Alternative Catalog Number: BYT-ORB1096693-20, BYT-ORB1096693-100, BYT-ORB1096693-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: S glycoprotein, E2, Peplomer protein

Product Description

Recombinant Human Novel Coronavirus Spike glycoprotein(S)(N501Y,P681H),partial

Product Properties

• Molecular Weight: 104.4 kDa
• UniProt: P0DTC2
• Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Source: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGY

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration