Mouse Tmprss2 Protein

Catalog Number: BYT-ORB1477254
Article Name: Mouse Tmprss2 Protein
Biozol Catalog Number: BYT-ORB1477254
Supplier Catalog Number: orb1477254
Alternative Catalog Number: BYT-ORB1477254-20,BYT-ORB1477254-100,BYT-ORB1477254-500,BYT-ORB1477254-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (Epitheliasin)(Plasmic transmembrane protein X)
Recombinant Mouse Transmembrane protease serine 2(Tmprss2),partial
Molecular Weight: 44.7 kDa
UniProt: Q9JIQ8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WRFWDSNCSTSEMECGSSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYGRAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDL
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration