PVRL2 / CD112 Antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: PVRL2 / CD112 Antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: BYT-ORB1536657
• Supplier Catalog Number: orb1536657
• Alternative Catalog Number: BYT-ORB1536657-50
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IF, IHC, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
• Conjugation: Unconjugated
• Alternative Names: PVRL2, HVEB, Herpesvirus entry protein B, Poliovirus receptor-like 2, Nectin-2, PRR2, PVRR2, CD112, CD112 antigen, Herpes virus entry mediator B, Herpesvirus entry mediator B, NECTIN2

Product Description

PVRL2 / CD112 Antibody

Product Properties

• Clonality: Polyclonal
• Concentration: 1.22 mg/ml
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Target: PVRL2 / CD112

Application Notes

• Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
• Application Notes: Further information: The predicted MW is 51kDa/57kDa, while the observed MW by Western blot was 72kDa.