Recombinant Mesocricetus auratus Angiotensin-converting enzyme (Ace2), partial

Catalog Number: BYT-ORB1785123
Article Name: Recombinant Mesocricetus auratus Angiotensin-converting enzyme (Ace2), partial
Biozol Catalog Number: BYT-ORB1785123
Supplier Catalog Number: orb1785123
Alternative Catalog Number: BYT-ORB1785123-20,BYT-ORB1785123-100,BYT-ORB1785123-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Recombinant Mesocricetus auratus Angiotensin-converting enzyme (Ace2), partial
Molecular Weight: 70.2 kDa
UniProt: A0A1U7QTA1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mesocricetus auratus (Golden hamster)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IIEEQAKTFLDKFNQEAEDLSYQSALASWNYNTNITEENAQKMNEAAAKWSAFYEEQSKLAKNYSLQEVQNLTIKRQLQALQQSGSSALSADKNKQLNTILNTMSTIYSTGKVCNPKNPQECLLLEPGLDDIMATSTDYNERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYEDYGDYWRGDYEAEGADGYNYNGNQLIEDVERTFKEIKPLYEQLHAYVRTKLMNTYPSYISPTGCLPAHLLGDMWGR
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration