Recombinant Human Protein C1orf43 (C1orf43), partial

Product Overview

• Article Name: Recombinant Human Protein C1orf43 (C1orf43), partial
• Biozol Catalog Number: BYT-ORB1785621
• Supplier Catalog Number: orb1785621
• Alternative Catalog Number: BYT-ORB1785621-20,BYT-ORB1785621-100,BYT-ORB1785621-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (Hepatitis C virus NS5A-transactivated protein 4)(HCV NS5A-transactivated protein 4)(Protein NICE-3)(S863-3)

Product Description

Recombinant Human Protein C1orf43 (C1orf43), partial

Product Properties

• Molecular Weight: 32.9 kDa
• UniProt: Q9BWL3
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: KRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration