ACTH/POMC Antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: ACTH/POMC Antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: BYT-ORB182371
• Supplier Catalog Number: orb182371
• Alternative Catalog Number: BYT-ORB182371-10, BYT-ORB182371-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACTH (138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.
• Conjugation: Unconjugated
• Alternative Names: Pro-opiomelanocortin,POMC,Corticotropin-lipotropin,NPP,Melanotropin gamma,Gamma-MSH,Potential peptide,Corticotropin,Adrenocorticotropic hormone,ACTH,Melanotropin alpha,Alpha-MSH,Corticotropin-like intermediary peptide,CLIP,Lipotropin beta,Beta-LPH,Lipotr

Product Description

ACTH/POMC Antibody

Product Properties

• Clonality: Polyclonal
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molecular Weight: 29424 MW
• Sensitivity: > 5000 cells
• UniProt: P01189
• Form: Lyophilized

Application Notes

• Application Notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for