SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc)

Catalog Number: BYT-ORB1976429
Article Name: SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc)
Biozol Catalog Number: BYT-ORB1976429
Supplier Catalog Number: orb1976429
Alternative Catalog Number: BYT-ORB1976429-20, BYT-ORB1976429-100, BYT-ORB1976429-500
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: sars-cov-2
SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc) is expressed in HEK293 mammalian cells with C-hFC-Flag tag. The predicted molecular weight is 44.5 kDa and the accession number is P0DTD1 YP_009742616.1.
Molecular Weight: 44.5 kDa (predicted)
UniProt: P0DTD1
Source: SARS-CoV-2
Purity: 98.00%
Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Application Notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 µg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or