SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His)

Catalog Number: BYT-ORB1976430
Article Name: SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His)
Biozol Catalog Number: BYT-ORB1976430
Supplier Catalog Number: orb1976430
Alternative Catalog Number: BYT-ORB1976430-20, BYT-ORB1976430-100, BYT-ORB1976430-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: sars-cov-2
SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His) is expressed in E. coli.
Molecular Weight: 13.9 kDa (predicted)
Source: SARS-CoV-2
Purity: 98.00%
Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Application Notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 µg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or