SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His)

Catalog Number: BYT-ORB1976431
Article Name: SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His)
Biozol Catalog Number: BYT-ORB1976431
Supplier Catalog Number: orb1976431
Alternative Catalog Number: BYT-ORB1976431-20, BYT-ORB1976431-100, BYT-ORB1976431-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: sars-cov-2
SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 41.7 kDa and the accession number is YP_009725299.1.
Molecular Weight: 41.7 kDa (predicted)
Source: SARS-CoV-2
Purity: 98.00%
Sequence: EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELK
Application Notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 µg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or