SARS-CoV-2 3C-like proteinase NSP5 Protein (His)

Catalog Number: BYT-ORB1976432
Article Name: SARS-CoV-2 3C-like proteinase NSP5 Protein (His)
Biozol Catalog Number: BYT-ORB1976432
Supplier Catalog Number: orb1976432
Alternative Catalog Number: BYT-ORB1976432-20, BYT-ORB1976432-100, BYT-ORB1976432-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: sars-cov-2
SARS-CoV-2 3C-like proteinase NSP5 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 39.8 kDa and the accession number is YP_009725301.1.
Molecular Weight: 39.8 kDa (predicted)
Source: SARS-CoV-2
Purity: 98.00%
Sequence: SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLS
Application Notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 µg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or