TMPRSS2 Protein, Human, Recombinant (His & Myc)

Catalog Number: BYT-ORB1977681
Article Name: TMPRSS2 Protein, Human, Recombinant (His & Myc)
Biozol Catalog Number: BYT-ORB1977681
Supplier Catalog Number: orb1977681
Alternative Catalog Number: BYT-ORB1977681-20,BYT-ORB1977681-100,BYT-ORB1977681-500
Manufacturer: Biorbyt
Category: Proteine/Peptide
Plasma membrane-anchored serine protease that participates in proteolytic cascades of relevance for the normal physiologic function of the prostate. Androgen-induced TMPRSS2 activates several substrates that include pro-hepatocyte growth factor/HGF, the
Molecular Weight: 47.8 kDa (predicted)
UniProt: O15393
Source: Human
Purity: 98.00%
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Application Notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 µg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or