TMPRSS2 Protein, Human, Recombinant (E. coli, His)

Catalog Number: BYT-ORB1977682
Article Name: TMPRSS2 Protein, Human, Recombinant (E. coli, His)
Biozol Catalog Number: BYT-ORB1977682
Supplier Catalog Number: orb1977682
Alternative Catalog Number: BYT-ORB1977682-20,BYT-ORB1977682-100,BYT-ORB1977682-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Plasma membrane-anchored serine protease that participates in proteolytic cascades of relevance for the normal physiologic function of the prostate. Androgen-induced TMPRSS2 activates several substrates that include pro-hepatocyte growth factor/HGF, the
Molecular Weight: 46.9 kDa (predicted)
UniProt: O15393
Source: Human
Purity: 98.00%
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Application Notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.