TMPRSS2 Protein, Human, Recombinant (E. coli, His)

Product Overview

• Article Name: TMPRSS2 Protein, Human, Recombinant (E. coli, His)
• Biozol Catalog Number: BYT-ORB1977682
• Supplier Catalog Number: orb1977682
• Alternative Catalog Number: BYT-ORB1977682-20,BYT-ORB1977682-100,BYT-ORB1977682-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

Plasma membrane-anchored serine protease that participates in proteolytic cascades of relevance for the normal physiologic function of the prostate. Androgen-induced TMPRSS2 activates several substrates that include pro-hepatocyte growth factor/HGF, the

Product Properties

• Molecular Weight: 46.9 kDa (predicted)
• UniProt: O15393
• Source: Human
• Purity: 98.00%
• Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND

Application Notes

• Application Notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.