TMPRSS2 Protein, Human, Recombinant (Cell-Free, His)

Catalog Number: BYT-ORB1977683
Article Name: TMPRSS2 Protein, Human, Recombinant (Cell-Free, His)
Biozol Catalog Number: BYT-ORB1977683
Supplier Catalog Number: orb1977683
Alternative Catalog Number: BYT-ORB1977683-20,BYT-ORB1977683-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
TMPRSS2 Protein, Human, Recombinant (Cell-Free, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 46.9 kDa and the accession number is O15393.
Molecular Weight: 46.9 kDa (predicted)
UniProt: O15393
Source: Human
Purity: 98.00%
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Application Notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 µg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or