CHRNA10 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083552
| Article Name: |
CHRNA10 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2083552 |
| Supplier Catalog Number: |
orb2083552 |
| Alternative Catalog Number: |
BYT-ORB2083552-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CHRNA10 |
| Conjugation: |
Biotin |
| Alternative Names: |
CHRNA10, NACHRA10, |
| CHRNA10 Antibody - N-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
49kDa |
| NCBI: |
065135 |
| UniProt: |
Q9GZZ6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: GGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPA |
