CDCP1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083560
Article Name: CDCP1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083560
Supplier Catalog Number: orb2083560
Alternative Catalog Number: BYT-ORB2083560-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDCP1
Conjugation: FITC
Alternative Names: CD318, TRASK, SIMA135
CDCP1 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 71kDa
UniProt: Q9H5V8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ICCVKKKKKKTNKGPAVGIYNDNINTEMPRQPKKFQKGRKDNDSHVYAVI