CD63 Antibody - middle region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083564
Article Name: |
CD63 Antibody - middle region : Biotin, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2083564 |
Supplier Catalog Number: |
orb2083564 |
Alternative Catalog Number: |
BYT-ORB2083564-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC, WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human CD63 |
Conjugation: |
Biotin |
Alternative Names: |
MLA1, ME491, LAMP-3, OMA81H, TSPAN30 |
CD63 Antibody - middle region : Biotin |
Clonality: |
Polyclonal |
Molecular Weight: |
26kDa |
NCBI: |
001771 |
UniProt: |
P08962 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: AAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAA |