CD63 Antibody - middle region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083564
| Article Name: |
CD63 Antibody - middle region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2083564 |
| Supplier Catalog Number: |
orb2083564 |
| Alternative Catalog Number: |
BYT-ORB2083564-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human CD63 |
| Conjugation: |
Biotin |
| Alternative Names: |
MLA1, ME491, LAMP-3, OMA81H, TSPAN30 |
| CD63 Antibody - middle region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
26kDa |
| NCBI: |
001771 |
| UniProt: |
P08962 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: AAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAA |
