BRSK2 Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083572
Article Name: |
BRSK2 Antibody - middle region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2083572 |
Supplier Catalog Number: |
orb2083572 |
Alternative Catalog Number: |
BYT-ORB2083572-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human BRSK2 |
Conjugation: |
FITC |
Alternative Names: |
SAD1, SADA, STK29, PEN11B, C11orf7 |
BRSK2 Antibody - middle region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
84kDa |
UniProt: |
Q8IWQ3 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: EEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDPPRKRVDSPMLNRHG |