BRSK2 Antibody - middle region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083573
| Article Name: |
BRSK2 Antibody - middle region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2083573 |
| Supplier Catalog Number: |
orb2083573 |
| Alternative Catalog Number: |
BYT-ORB2083573-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human BRSK2 |
| Conjugation: |
Biotin |
| Alternative Names: |
SAD1, SADA, STK29, PEN11B, C11orf7 |
| BRSK2 Antibody - middle region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
84kDa |
| UniProt: |
Q8IWQ3 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: EEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDPPRKRVDSPMLNRHG |
