BMPR1A Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083575
| Article Name: |
BMPR1A Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2083575 |
| Supplier Catalog Number: |
orb2083575 |
| Alternative Catalog Number: |
BYT-ORB2083575-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BMPR1A |
| Conjugation: |
FITC |
| Alternative Names: |
ALK3, SKR5, CD292, ACVRLK3, 10q23del |
| BMPR1A Antibody - N-terminal region : FITC |
| Clonality: |
Polyclonal |
| Molecular Weight: |
58kDa |
| NCBI: |
005270121 |
| UniProt: |
P36894 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: GMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCF |
