BATF Antibody - N-terminal : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083587
Article Name: BATF Antibody - N-terminal : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083587
Supplier Catalog Number: orb2083587
Alternative Catalog Number: BYT-ORB2083587-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat BATF
Conjugation: FITC
Alternative Names: B-ATF
BATF Antibody - N-terminal : FITC
Clonality: Polyclonal
Molecular Weight: 13 kDa
NCBI: 008762980
UniProt: D4A7E1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQK