ATP6V0A4 Antibody - middle region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083593
Article Name: ATP6V0A4 Antibody - middle region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083593
Supplier Catalog Number: orb2083593
Alternative Catalog Number: BYT-ORB2083593-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATP6V0A4
Conjugation: FITC
Alternative Names: A4, STV1, VPH1, VPP2, DRTA3, RTA1C, RTADR, ATP6N2, RDRTA2, ATP6N1B
ATP6V0A4 Antibody - middle region : FITC
Clonality: Polyclonal
Molecular Weight: 82kDa
UniProt: Q9HBG4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ADATRIKRALEQGMELSGSSMAPIMTTVQSKTAPPTFNRTNKFTAGFQNI