ATP6V0A2 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083597
| Article Name: |
ATP6V0A2 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2083597 |
| Supplier Catalog Number: |
orb2083597 |
| Alternative Catalog Number: |
BYT-ORB2083597-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATP6V0A2 |
| Conjugation: |
Biotin |
| Alternative Names: |
A2, RTF, TJ6, WSS, a2V, ARCL, J6B7, STV1, TJ6M, TJ6S, VPH1, ARCL2A, ATP6A2, ATP6N1D |
| ATP6V0A2 Antibody - N-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
94kDa |
| NCBI: |
036595 |
| UniProt: |
Q9Y487 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQV |
