Arfrp1 Antibody - N-terminal : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083602
| Article Name: |
Arfrp1 Antibody - N-terminal : FITC, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2083602 |
| Supplier Catalog Number: |
orb2083602 |
| Alternative Catalog Number: |
BYT-ORB2083602-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen for Anti-Arfrp1 antibody is: synthetic peptide directed towards the N-terminal of Rat ARFRP |
| Conjugation: |
FITC |
| Arfrp1 Antibody - N-terminal : FITC |
| Clonality: |
Polyclonal |
| Molecular Weight: |
22 kDa |
| NCBI: |
006235780 |
| UniProt: |
Q63055 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: TLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSK |
