Arfrp1 Antibody - N-terminal : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2083603
Article Name: |
Arfrp1 Antibody - N-terminal : Biotin, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2083603 |
Supplier Catalog Number: |
orb2083603 |
Alternative Catalog Number: |
BYT-ORB2083603-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen for Anti-Arfrp1 antibody is: synthetic peptide directed towards the N-terminal of Rat ARFRP |
Conjugation: |
Biotin |
Arfrp1 Antibody - N-terminal : Biotin |
Clonality: |
Polyclonal |
Molecular Weight: |
22 kDa |
NCBI: |
006235780 |
UniProt: |
Q63055 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: TLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSK |