ANKRD17 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083612
Article Name: ANKRD17 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083612
Supplier Catalog Number: orb2083612
Alternative Catalog Number: BYT-ORB2083612-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANKRD17
Conjugation: Biotin
Alternative Names: GTAR, MASK2, NY-BR-16
ANKRD17 Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 82kDa
UniProt: O75179
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PRGMVRVCDLLLKKKPPQQQHHKAKRNRTCRPPSSSESSSDSDNSGGGGG