ALDH1A1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2083613
Article Name: ALDH1A1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2083613
Supplier Catalog Number: orb2083613
Alternative Catalog Number: BYT-ORB2083613-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ALDH1A1
Conjugation: HRP
Alternative Names: ALDC, ALDH1, HEL-9, HEL12, PUMB1, ALDH11, RALDH1, ALDH-E1, HEL-S-53e
ALDH1A1 Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 005251857
UniProt: P00352
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: KILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIF